PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A13G0688
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 313aa    MW: 35468.5 Da    PI: 8.6596
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A13G0688genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.79.5e-171764148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+eEd++l  +++q G g+W++ +++ g++R++k+c++rw +yl
      Gh_A13G0688 17 RGPWTAEEDQILMAYIQQRGHGNWRALPEKAGLKRCGKSCRLRWINYL 64
                     89********************************************97 PP

2Myb_DNA-binding48.52e-1570115148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+++ +E+  +++++++lG++ W++ a++++ +Rt++++k++w+++l
      Gh_A13G0688  70 RGKFSLQEEHTIIQLHALLGNR-WSAMAAHLP-KRTDNEIKNYWNTHL 115
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.4141264IPR017930Myb domain
SuperFamilySSF466892.77E-2914111IPR009057Homeodomain-like
SMARTSM007175.0E-121666IPR001005SANT/Myb domain
PfamPF002491.1E-141764IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-231871IPR009057Homeodomain-like
CDDcd001672.00E-91964No hitNo description
PROSITE profilePS5129423.26465119IPR017930Myb domain
SMARTSM007173.3E-1469117IPR001005SANT/Myb domain
PfamPF002498.1E-1570115IPR001005SANT/Myb domain
CDDcd001671.26E-972115No hitNo description
Gene3DG3DSA:1.10.10.609.7E-2672120IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MGRRLPLNGH KEVGLKRGPW TAEEDQILMA YIQQRGHGNW RALPEKAGLK RCGKSCRLRW  60
INYLRPDIKR GKFSLQEEHT IIQLHALLGN RWSAMAAHLP KRTDNEIKNY WNTHLKKRLI  120
KLGVDPMTHK PRTDAASFPS GSNLTHMAQW ESARLEAEAR LVRGSKQVVP NPIHPKNHLT  180
LNHSQLRPRC LDVLQAWQGV VAGMFAFPTQ DLGSPTSTLR LPAIGLNATS YTDCEMGFDD  240
SLKYIENSNQ MKEIEETITD GCIDEWFEDS FRVGNYESVP MAVDGSNCCG SVFDLVNSSP  300
YGLSMLYDHN VMK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-24151195108B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.103605e-58boll| ovule
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO133461875e-58
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3362833e-55AF336283.1 Gossypium hirsutum GHMYB25 (ghmyb25) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012461787.10.0PREDICTED: myb-related protein Pp1-like
TrEMBLA0A0B0N4W70.0A0A0B0N4W7_G
STRINGPOPTR_0008s08920.11e-103(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2244245
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15310.11e-86myb domain protein 16